PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco007995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 184aa    MW: 20772.8 Da    PI: 5.8619
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco007995.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.88.9e-261058250
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 rien   rqvtf+kRr g+lKKA+ELSvLCdae+ vi+fs +gklye +
  Aco007995.1 10 RIENPVHRQVTFCKRRGGLLKKANELSVLCDAEIGVIMFSANGKLYELA 58
                 8*********************************************965 PP

2K-box24.31.3e-0980163799
        K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedL.esLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  +s e ++++  +qe+  Lk+ei+ Lq+ +R + G++    +++ eLq +e++Le           +++ ++i+ l++ke  l+ +n+ L++k+ 
  Aco007995.1  80 ESSEVNQSQVAEQEVFMLKQEIDLLQKGLRYIYGDGTaAHMTFDELQAVERNLE----------IQIMAQEIQMLRNKEGILKTANQILQTKII 163
                  44667788999************************87258*************9..........589***********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554559.03E-29175IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.843161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-35160IPR002100Transcription factor, MADS-box
CDDcd002651.94E-37271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-27323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.0E-1181162IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRGGLLK KANELSVLCD AEIGVIMFSA NGKLYELATN  60
GNMQNLIERY KRIGVEGQAE SSEVNQSQVA EQEVFMLKQE IDLLQKGLRY IYGDGTAAHM  120
TFDELQAVER NLEIQIMAQE IQMLRNKEGI LKTANQILQT KIIEQNGLFD NVAVDDSNIS  180
RDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-15370268Myocyte-specific enhancer factor 2A
3mu6_B2e-15370268Myocyte-specific enhancer factor 2A
3mu6_C2e-15370268Myocyte-specific enhancer factor 2A
3mu6_D2e-15370268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912876.15e-86PREDICTED: MADS-box transcription factor 26-like
SwissprotQ2QW553e-75MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLI1IY591e-79I1IY59_BRADI; MADS-box transcription factor 36
TrEMBLM4MBK51e-79M4MBK5_ANACO; MADS-box transcription factor
STRINGBRADI5G11270.13e-79(Brachypodium distachyon)
STRINGGSMUA_Achr11P19350_0015e-79(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.15e-57AGAMOUS-like 12